PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400020289
Common NameLOC102583101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 340aa    MW: 37283.4 Da    PI: 4.7236
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400020289genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.21.7e-33164222159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDg++WrKYGqK vk+s+fprsYYrCt+a+C vkk+vers+edp++v++tYeg H+h+
  PGSC0003DMP400020289 164 LDDGFRWRKYGQKAVKNSPFPRSYYRCTTATCGVKKRVERSSEDPSIVVTTYEGVHTHP 222
                           59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.5E-34149224IPR003657WRKY domain
SuperFamilySSF1182902.09E-29156224IPR003657WRKY domain
PROSITE profilePS5081131.1159224IPR003657WRKY domain
SMARTSM007744.1E-40164223IPR003657WRKY domain
PfamPF031069.2E-27165222IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MDENEKKKLK PTETMSALFP DESSSFFFDM PLCETEKGSS SPMSLIESMF ASHDDPITDS  60
SSLFDLLQPP PSPPPPPPPP PPDVALLIPS PIANTSANSS EISSSSTEVA ANDEHQQMIE  120
TVEQQLENDE DKIDNLQLNP KKRKARKERE PRFAFMTKSE IDHLDDGFRW RKYGQKAVKN  180
SPFPRSYYRC TTATCGVKKR VERSSEDPSI VVTTYEGVHT HPCPVTPRGS IGFFPETTGY  240
SGGSIGGLGV GLGGVASNSS LFFPEFNYQV QPQQSTYFQT PTLPPINSFT TDSSLFSTTN  300
SSQEGMLSPS TSSSLARDHG LLQDMVPSQM RPTDPKQNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-261572241077Probable WRKY transcription factor 4
2lex_A1e-261572241077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2465441e-103AC246544.4 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-67c1 map 1, complete sequence.
GenBankHG9755131e-103HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006354313.10.0PREDICTED: probable WRKY transcription factor 48
SwissprotQ9FGZ46e-52WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLM1ATF40.0M1ATF4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000298120.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13092479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.11e-45WRKY DNA-binding protein 48
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]